BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os06g0317400 Os06g0317400|J065155L01
         (153 letters)

Database: rap3 
           52,214 sequences; 17,035,801 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Os06g0317400  Glycine rich family protein                          65   2e-11

>Os06g0317400 Glycine rich family protein
          Length = 153

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 30/30 (100%), Positives = 30/30 (100%)

Query: 27 RELTEANEAKGKNMEPEVVHVPQDEKIAYH 56
          RELTEANEAKGKNMEPEVVHVPQDEKIAYH
Sbjct: 27 RELTEANEAKGKNMEPEVVHVPQDEKIAYH 56



  Database: rap3
    Posted date:  Nov 19, 2010  6:03 PM
  Number of letters in database: 17,035,801
  Number of sequences in database:  52,214
  
Lambda     K      H
   0.310    0.126    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 52214
Number of Hits to DB: 903,489
Number of extensions: 14545
Number of successful extensions: 25
Number of sequences better than 1.0e-10: 1
Number of HSP's gapped: 25
Number of HSP's successfully gapped: 1
Length of query: 153
Length of database: 17,035,801
Length adjustment: 92
Effective length of query: 61
Effective length of database: 12,232,113
Effective search space: 746158893
Effective search space used: 746158893
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 151 (62.8 bits)