BLASTP 2.2.23 [Feb-03-2010]
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= Os04g0479900 Os04g0479900|J065025A06
(128 letters)
Database: rap3
52,214 sequences; 17,035,801 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
Os04g0479900 Conserved hypothetical protein 122 6e-29
>Os04g0479900 Conserved hypothetical protein
Length = 128
Score = 122 bits (306), Expect = 6e-29, Method: Compositional matrix adjust.
Identities = 69/69 (100%), Positives = 69/69 (100%)
Query: 39 SVRLVTPPHRSPCRWAGGAVPRGRGHGRQFPPPPRRPHDQWYARSGLACRECRESSRQGR 98
SVRLVTPPHRSPCRWAGGAVPRGRGHGRQFPPPPRRPHDQWYARSGLACRECRESSRQGR
Sbjct: 39 SVRLVTPPHRSPCRWAGGAVPRGRGHGRQFPPPPRRPHDQWYARSGLACRECRESSRQGR 98
Query: 99 RPQHHGGLH 107
RPQHHGGLH
Sbjct: 99 RPQHHGGLH 107
Database: rap3
Posted date: Nov 19, 2010 6:03 PM
Number of letters in database: 17,035,801
Number of sequences in database: 52,214
Lambda K H
0.320 0.138 0.491
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 52214
Number of Hits to DB: 4,419,931
Number of extensions: 220253
Number of successful extensions: 1177
Number of sequences better than 1.0e-10: 1
Number of HSP's gapped: 1177
Number of HSP's successfully gapped: 1
Length of query: 128
Length of database: 17,035,801
Length adjustment: 89
Effective length of query: 39
Effective length of database: 12,388,755
Effective search space: 483161445
Effective search space used: 483161445
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 150 (62.4 bits)