BLASTP 2.2.23 [Feb-03-2010]
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= Os03g0285200 Os03g0285200|J065121H18
(59 letters)
Database: rap3
52,214 sequences; 17,035,801 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
Os03g0285200 Conserved hypothetical protein 93 4e-20
>Os03g0285200 Conserved hypothetical protein
Length = 59
Score = 93.2 bits (230), Expect = 4e-20, Method: Compositional matrix adjust.
Identities = 45/45 (100%), Positives = 45/45 (100%)
Query: 1 MERQQDTRRPLPRRGQVKAGIFASLFRCIFPGEKEASQKLKEGNS 45
MERQQDTRRPLPRRGQVKAGIFASLFRCIFPGEKEASQKLKEGNS
Sbjct: 1 MERQQDTRRPLPRRGQVKAGIFASLFRCIFPGEKEASQKLKEGNS 45
Database: rap3
Posted date: Nov 19, 2010 6:03 PM
Number of letters in database: 17,035,801
Number of sequences in database: 52,214
Lambda K H
0.319 0.135 0.391
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 52214
Number of Hits to DB: 1,449,057
Number of extensions: 34370
Number of successful extensions: 63
Number of sequences better than 1.0e-10: 1
Number of HSP's gapped: 63
Number of HSP's successfully gapped: 1
Length of query: 59
Length of database: 17,035,801
Length adjustment: 31
Effective length of query: 28
Effective length of database: 15,417,167
Effective search space: 431680676
Effective search space used: 431680676
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 149 (62.0 bits)