BLASTP 2.2.23 [Feb-03-2010]
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= Os02g0168400 Os02g0168400|J065058G05
(53 letters)
Database: rap3
52,214 sequences; 17,035,801 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
Os02g0168400 Hypothetical protein 82 9e-17
>Os02g0168400 Hypothetical protein
Length = 53
Score = 82.0 bits (201), Expect = 9e-17, Method: Compositional matrix adjust.
Identities = 38/38 (100%), Positives = 38/38 (100%)
Query: 1 NRTTQILEFLKELKNGGCLNTMHILLVYLQQAPIAQHP 38
NRTTQILEFLKELKNGGCLNTMHILLVYLQQAPIAQHP
Sbjct: 1 NRTTQILEFLKELKNGGCLNTMHILLVYLQQAPIAQHP 38
Database: rap3
Posted date: Nov 19, 2010 6:03 PM
Number of letters in database: 17,035,801
Number of sequences in database: 52,214
Lambda K H
0.321 0.135 0.396
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 52214
Number of Hits to DB: 1,152,981
Number of extensions: 20955
Number of successful extensions: 40
Number of sequences better than 1.0e-10: 1
Number of HSP's gapped: 40
Number of HSP's successfully gapped: 1
Length of query: 53
Length of database: 17,035,801
Length adjustment: 26
Effective length of query: 27
Effective length of database: 15,678,237
Effective search space: 423312399
Effective search space used: 423312399
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 149 (62.0 bits)