BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os12g0548700 Os12g0548700|AK058739
         (68 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT2G38870.1  | chr2:16236546-16237050 REVERSE LENGTH=71            52   8e-08

>AT2G38870.1 | chr2:16236546-16237050 REVERSE LENGTH=71
          Length = 70

 Score = 51.6 bits (122), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 33/51 (64%)

Query: 9  KTSWPEVVGLRAEEAKKVILKDMPDADIVVVPVGTPVTMDFRPNRVRIFVD 59
          K SWPE+ G   + A  VI ++ P  +  V+  G+PVT DFR +RVR+FVD
Sbjct: 8  KNSWPELTGTNGDYAAVVIERENPTVNAAVILDGSPVTADFRCDRVRVFVD 58



  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.316    0.136    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 1,494,780
Number of extensions: 48979
Number of successful extensions: 75
Number of sequences better than 1.0e-05: 2
Number of HSP's gapped: 75
Number of HSP's successfully gapped: 2
Length of query: 68
Length of database: 11,106,569
Length adjustment: 40
Effective length of query: 28
Effective length of database: 10,009,929
Effective search space: 280278012
Effective search space used: 280278012
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 105 (45.1 bits)