BLASTP 2.2.23 [Feb-03-2010]
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= Os12g0203100 Os12g0203100|012-048-F01
(89 letters)
Database: tair10
27,416 sequences; 11,106,569 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AT1G22800.1 | chr1:8072020-8074039 FORWARD LENGTH=356 60 2e-10
>AT1G22800.1 | chr1:8072020-8074039 FORWARD LENGTH=356
Length = 355
Score = 60.5 bits (145), Expect = 2e-10, Method: Composition-based stats.
Identities = 25/30 (83%), Positives = 29/30 (96%)
Query: 25 IRELRIACTIAQMEREGGISPRMSPLAQVR 54
++ELRIACT+A MEREGGISPR+SPLAQVR
Sbjct: 210 LKELRIACTLAHMEREGGISPRLSPLAQVR 239
Database: tair10
Posted date: Dec 8, 2010 11:30 AM
Number of letters in database: 11,106,569
Number of sequences in database: 27,416
Lambda K H
0.334 0.144 0.471
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 1,904,406
Number of extensions: 63150
Number of successful extensions: 199
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 199
Number of HSP's successfully gapped: 1
Length of query: 89
Length of database: 11,106,569
Length adjustment: 60
Effective length of query: 29
Effective length of database: 9,461,609
Effective search space: 274386661
Effective search space used: 274386661
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)
S2: 104 (44.7 bits)