BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os11g0667400 Os11g0667400|Os11g0667400
         (119 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT5G22030.2  | chr5:7290155-7296344 REVERSE LENGTH=914             47   2e-06
>AT5G22030.2 | chr5:7290155-7296344 REVERSE LENGTH=914
          Length = 913

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 28/46 (60%)

Query: 73  ATGSSGHSSQKHEEGKGWYKFDDECVRPITEDSIKTPAAYVLFYTR 118
           + G   +++  H  G  WY FDD  V  I+++ IKT AAYVLFY R
Sbjct: 865 SMGGGHYTAYVHHGGDRWYDFDDSHVHQISQEKIKTSAAYVLFYKR 910
  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.312    0.131    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 2,710,415
Number of extensions: 107062
Number of successful extensions: 298
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 298
Number of HSP's successfully gapped: 1
Length of query: 119
Length of database: 11,106,569
Length adjustment: 85
Effective length of query: 34
Effective length of database: 8,776,209
Effective search space: 298391106
Effective search space used: 298391106
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 105 (45.1 bits)