BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os11g0546200 Os11g0546200|J065207I24
         (88 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT5G37290.1  | chr5:14762730-14764097 FORWARD LENGTH=181           73   4e-14
>AT5G37290.1 | chr5:14762730-14764097 FORWARD LENGTH=181
          Length = 180

 Score = 72.8 bits (177), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 35/65 (53%), Positives = 48/65 (73%), Gaps = 2/65 (3%)

Query: 26  SIPMISQVNYALGALYYLC--NPSTKKDILKPEVLKAVREYAVAGDANTSFRNLANAFLD 83
           S P+ + VNYALGALYY+C  N +T+++IL+PEV+  +  YA A   + SF NLA AFLD
Sbjct: 114 SSPVRNTVNYALGALYYMCDYNRATREEILRPEVVDLIERYAAAESVSVSFSNLAKAFLD 173

Query: 84  KHVNS 88
           KHV++
Sbjct: 174 KHVHA 178
  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.322    0.134    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 1,851,151
Number of extensions: 61551
Number of successful extensions: 189
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 188
Number of HSP's successfully gapped: 1
Length of query: 88
Length of database: 11,106,569
Length adjustment: 59
Effective length of query: 29
Effective length of database: 9,489,025
Effective search space: 275181725
Effective search space used: 275181725
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 104 (44.7 bits)