BLASTP 2.2.23 [Feb-03-2010]
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= Os11g0302500 Os11g0302500|AK120763
(68 letters)
Database: tair10
27,416 sequences; 11,106,569 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AT5G50375.2 | chr5:20511856-20514081 FORWARD LENGTH=285 80 2e-16
>AT5G50375.2 | chr5:20511856-20514081 FORWARD LENGTH=285
Length = 284
Score = 80.1 bits (196), Expect = 2e-16, Method: Compositional matrix adjust.
Identities = 34/40 (85%), Positives = 39/40 (97%)
Query: 22 LQANIWIIIFSYVGNYFWTHYFFTVLGASYTFPSWRMNNV 61
++AN+WII+FSYVGNYFWTHYFF VLGASYTFPSW+MNNV
Sbjct: 87 VKANLWIIVFSYVGNYFWTHYFFKVLGASYTFPSWKMNNV 126
Database: tair10
Posted date: Dec 8, 2010 11:30 AM
Number of letters in database: 11,106,569
Number of sequences in database: 27,416
Lambda K H
0.332 0.139 0.485
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 1,506,563
Number of extensions: 47568
Number of successful extensions: 187
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 187
Number of HSP's successfully gapped: 1
Length of query: 68
Length of database: 11,106,569
Length adjustment: 40
Effective length of query: 28
Effective length of database: 10,009,929
Effective search space: 280278012
Effective search space used: 280278012
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.5 bits)
S2: 105 (45.1 bits)