BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os11g0204800 Os11g0204800|AK100488
         (75 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT5G19140.1  | chr5:6423398-6425785 FORWARD LENGTH=235             52   5e-08
>AT5G19140.1 | chr5:6423398-6425785 FORWARD LENGTH=235
          Length = 234

 Score = 52.4 bits (124), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 29/57 (50%), Positives = 36/57 (63%), Gaps = 2/57 (3%)

Query: 8  PVELLVAGSRTTSPKTRESELVSHFLGGTEPALSVQLGDLGHLAYSH--PMPTKPST 62
          P EL+ AGSRT SPKT  S LV+ F+     A+SVQ+GD   LAYSH    P +P +
Sbjct: 13 PEELVAAGSRTPSPKTTGSTLVNRFVEKNPSAVSVQVGDYVQLAYSHHNESPLRPRS 69
  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.314    0.131    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 1,659,493
Number of extensions: 54705
Number of successful extensions: 78
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 78
Number of HSP's successfully gapped: 1
Length of query: 75
Length of database: 11,106,569
Length adjustment: 47
Effective length of query: 28
Effective length of database: 9,818,017
Effective search space: 274904476
Effective search space used: 274904476
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 104 (44.7 bits)