BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os10g0318900 Os10g0318900|AK111448
         (209 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT1G09740.1  | chr1:3154603-3155834 FORWARD LENGTH=172             52   3e-07
>AT1G09740.1 | chr1:3154603-3155834 FORWARD LENGTH=172
          Length = 171

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/40 (62%), Positives = 30/40 (75%), Gaps = 3/40 (7%)

Query: 100 DNLRLRPDGA---LVVLHVQPPPSIAAGLNPGPIPFGGPS 136
           DNL+L    +    VVLHVQP PS+AAG++PG IPFGGPS
Sbjct: 29  DNLKLSSSSSDSSFVVLHVQPSPSVAAGVSPGTIPFGGPS 68
  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.325    0.138    0.467 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 3,716,937
Number of extensions: 139479
Number of successful extensions: 427
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 427
Number of HSP's successfully gapped: 1
Length of query: 209
Length of database: 11,106,569
Length adjustment: 94
Effective length of query: 115
Effective length of database: 8,529,465
Effective search space: 980888475
Effective search space used: 980888475
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 109 (46.6 bits)