BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os09g0538700 Os09g0538700|Os09g0538700
         (311 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT3G51290.1  | chr3:19039980-19042437 FORWARD LENGTH=635           50   1e-06

>AT3G51290.1 | chr3:19039980-19042437 FORWARD LENGTH=635
          Length = 634

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/34 (61%), Positives = 28/34 (82%)

Query: 1  MGLCQSRLERQEAVSRCKARRRYTKQLVQARRDM 34
          MG CQSR++ +E VSRCKAR+RY K LV+AR+ +
Sbjct: 1  MGCCQSRIDSKEIVSRCKARKRYLKHLVKARQTL 34



  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.321    0.133    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 2,754,527
Number of extensions: 64580
Number of successful extensions: 167
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 167
Number of HSP's successfully gapped: 1
Length of query: 311
Length of database: 11,106,569
Length adjustment: 98
Effective length of query: 213
Effective length of database: 8,419,801
Effective search space: 1793417613
Effective search space used: 1793417613
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 111 (47.4 bits)