BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os09g0514700 Os09g0514700|AK106676
         (530 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT3G59430.1  | chr3:21964484-21966497 REVERSE LENGTH=452           57   3e-08

>AT3G59430.1 | chr3:21964484-21966497 REVERSE LENGTH=452
          Length = 451

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 33/51 (64%)

Query: 1  MGLEESQKHLLGLNYHELQSLCKQYNLPANKSHSQLASSLALFLEKGRINP 51
          M  +E      G +  ELQSLCK+YNLPAN+S S +A SLA + EK  +NP
Sbjct: 1  MVRKEDVDFYCGFSRKELQSLCKKYNLPANRSSSDMAESLASYFEKNNLNP 51



  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.308    0.125    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 11,397,784
Number of extensions: 489423
Number of successful extensions: 1077
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 1077
Number of HSP's successfully gapped: 1
Length of query: 530
Length of database: 11,106,569
Length adjustment: 103
Effective length of query: 427
Effective length of database: 8,282,721
Effective search space: 3536721867
Effective search space used: 3536721867
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 114 (48.5 bits)