BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os09g0247700 Os09g0247700|AK059400
         (58 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT3G02260.1  | chr3:431152-448489 REVERSE LENGTH=5099              71   1e-13
>AT3G02260.1 | chr3:431152-448489 REVERSE LENGTH=5099
          Length = 5098

 Score = 70.9 bits (172), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/53 (56%), Positives = 43/53 (81%)

Query: 1    MKEMLGFSKDVLSWLEDMTSSEDLQEAFDVMGALPDVFSGGHTTCEDFVRAII 53
            +KEM+GFSK+++SWL+++ S+ DLQEAFD++G L DV S G T C+ FVR+ I
Sbjct: 5043 VKEMIGFSKELISWLDEINSATDLQEAFDIVGVLADVLSEGVTQCDQFVRSAI 5095
  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.319    0.134    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 1,291,353
Number of extensions: 37324
Number of successful extensions: 130
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 130
Number of HSP's successfully gapped: 1
Length of query: 58
Length of database: 11,106,569
Length adjustment: 31
Effective length of query: 27
Effective length of database: 10,256,673
Effective search space: 276930171
Effective search space used: 276930171
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 104 (44.7 bits)