BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os08g0393600 Os08g0393600|AK068190
         (115 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT5G10480.3  | chr5:3298047-3300048 REVERSE LENGTH=231             84   1e-17
>AT5G10480.3 | chr5:3298047-3300048 REVERSE LENGTH=231
          Length = 230

 Score = 84.3 bits (207), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 50/68 (73%)

Query: 32 MAGNASVMRRLYLSFYNWIVFIGWVQVSWSMILALLENGYEAVYAAVEQHLLFAQTAAIM 91
          MAG  SV+RR+YL+ YNWIVF GW QV +  I  L E GYE VY A+E+ L  AQTAA++
Sbjct: 1  MAGFLSVVRRVYLTLYNWIVFAGWAQVLYLAITTLKETGYENVYDAIEKPLQLAQTAAVL 60

Query: 92 EILHSIVG 99
          EILH +VG
Sbjct: 61 EILHGLVG 68
  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.325    0.133    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 1,869,988
Number of extensions: 51255
Number of successful extensions: 131
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 131
Number of HSP's successfully gapped: 1
Length of query: 115
Length of database: 11,106,569
Length adjustment: 84
Effective length of query: 31
Effective length of database: 8,803,625
Effective search space: 272912375
Effective search space used: 272912375
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 104 (44.7 bits)