BLASTP 2.2.23 [Feb-03-2010]
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= Os07g0619700 Os07g0619700|J075009A08
(338 letters)
Database: tair10
27,416 sequences; 11,106,569 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AT5G66840.1 | chr5:26692922-26695296 REVERSE LENGTH=552 54 1e-07
>AT5G66840.1 | chr5:26692922-26695296 REVERSE LENGTH=552
Length = 551
Score = 53.9 bits (128), Expect = 1e-07, Method: Compositional matrix adjust.
Identities = 19/44 (43%), Positives = 30/44 (68%)
Query: 7 FIVAGRNLDGIKLVDCKAYLKKNGLSQTGDLATCIERIVLHWRL 50
+ AG +L + + +CKAYL+K+GL +G CI+RI+ HWR+
Sbjct: 83 LLTAGSDLKSVNVKECKAYLRKHGLRLSGTKPVCIDRILEHWRI 126
Database: tair10
Posted date: Dec 8, 2010 11:30 AM
Number of letters in database: 11,106,569
Number of sequences in database: 27,416
Lambda K H
0.315 0.130 0.393
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 7,980,597
Number of extensions: 352801
Number of successful extensions: 1427
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 1428
Number of HSP's successfully gapped: 1
Length of query: 338
Length of database: 11,106,569
Length adjustment: 99
Effective length of query: 239
Effective length of database: 8,392,385
Effective search space: 2005780015
Effective search space used: 2005780015
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 112 (47.8 bits)