BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os07g0607200 Os07g0607200|AK065746
         (196 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT4G16410.1  | chr4:9262019-9262576 REVERSE LENGTH=186             81   4e-16

>AT4G16410.1 | chr4:9262019-9262576 REVERSE LENGTH=186
          Length = 185

 Score = 80.9 bits (198), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/71 (54%), Positives = 55/71 (77%)

Query: 125 EEFWDNMRRYALYVVTVSTGFAYTLAQPIVELLKNPVTALLIVAVLAGGGFLVSQVLNAM 184
           EEFWDN+RRY LY +TVSTG    + +PI ELLKNP++A+LI+ +L G  ++VSQV++AM
Sbjct: 114 EEFWDNVRRYGLYALTVSTGALSAVFEPIFELLKNPISAILILLILGGSFYIVSQVVSAM 173

Query: 185 VGNSDFIYTYD 195
           +G ++F Y Y 
Sbjct: 174 IGVNEFAYQYS 184



  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.321    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 2,585,016
Number of extensions: 68469
Number of successful extensions: 146
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 146
Number of HSP's successfully gapped: 1
Length of query: 196
Length of database: 11,106,569
Length adjustment: 93
Effective length of query: 103
Effective length of database: 8,556,881
Effective search space: 881358743
Effective search space used: 881358743
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 109 (46.6 bits)