BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os07g0561400 Os07g0561400|Os07g0561400
         (293 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT2G35930.1  | chr2:15083101-15084336 REVERSE LENGTH=412           57   8e-09

>AT2G35930.1 | chr2:15083101-15084336 REVERSE LENGTH=412
          Length = 411

 Score = 57.4 bits (137), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 37/54 (68%)

Query: 186 RPSAKAVKVALHVLYRLCPWSQNRVKAVDAGAVSALVRLLLNEGCGGDRRACEL 239
           R S KA K A+H+L  +CPW +NR KAV+AG +S ++ LL++E    +RR  E+
Sbjct: 243 RISQKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFTSERRGPEM 296



  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.322    0.131    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 2,778,809
Number of extensions: 54690
Number of successful extensions: 173
Number of sequences better than 1.0e-05: 2
Number of HSP's gapped: 173
Number of HSP's successfully gapped: 2
Length of query: 293
Length of database: 11,106,569
Length adjustment: 98
Effective length of query: 195
Effective length of database: 8,419,801
Effective search space: 1641861195
Effective search space used: 1641861195
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 111 (47.4 bits)