BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os07g0406600 Os07g0406600|J013002I21
         (84 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT1G31480.1  | chr1:11266225-11271527 FORWARD LENGTH=934           45   7e-06

>AT1G31480.1 | chr1:11266225-11271527 FORWARD LENGTH=934
          Length = 933

 Score = 45.4 bits (106), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 26/33 (78%), Gaps = 2/33 (6%)

Query: 36  SNYWRDHDTALFILKHLYHDIPE--ETPTDDPE 66
           +NYWRD DTALFI+KHLY ++P+   +PT+  E
Sbjct: 850 TNYWRDQDTALFIIKHLYRELPDGPNSPTESTE 882



  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.326    0.141    0.453 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 1,919,188
Number of extensions: 68181
Number of successful extensions: 186
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 186
Number of HSP's successfully gapped: 1
Length of query: 84
Length of database: 11,106,569
Length adjustment: 55
Effective length of query: 29
Effective length of database: 9,598,689
Effective search space: 278361981
Effective search space used: 278361981
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 104 (44.7 bits)