BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os07g0179200 Os07g0179200|AK059946
         (201 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT3G63400.1  | chr3:23412449-23415435 FORWARD LENGTH=571           58   4e-09

>AT3G63400.1 | chr3:23412449-23415435 FORWARD LENGTH=571
          Length = 570

 Score = 57.8 bits (138), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 1/61 (1%)

Query: 6   NGQPQRVRKGRGFTQQYAFARRYRTPSPERSPVRSRYNDGRNDRWNHFNRYGRNGPYGAR 65
           +G P+R+RKGRGFT++Y+FAR+Y TPSPERSP R  + D RN +  + +RY  N  Y  R
Sbjct: 407 SGVPKRIRKGRGFTERYSFARKYHTPSPERSPPR-HWPDRRNFQDRNRDRYPSNRSYSER 465

Query: 66  S 66
           S
Sbjct: 466 S 466



  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.317    0.137    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 2,876,699
Number of extensions: 95470
Number of successful extensions: 250
Number of sequences better than 1.0e-05: 2
Number of HSP's gapped: 248
Number of HSP's successfully gapped: 2
Length of query: 201
Length of database: 11,106,569
Length adjustment: 94
Effective length of query: 107
Effective length of database: 8,529,465
Effective search space: 912652755
Effective search space used: 912652755
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 109 (46.6 bits)