BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os07g0137000 Os07g0137000|AK110988
         (73 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT3G18100.1  | chr3:6200689-6204583 FORWARD LENGTH=848             62   7e-11

>AT3G18100.1 | chr3:6200689-6204583 FORWARD LENGTH=848
          Length = 847

 Score = 61.6 bits (148), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 48/70 (68%), Gaps = 6/70 (8%)

Query: 1   GRWRETLNPESSKVGSWSLDEDKRLMVPVKLFGSGSWNKILLSSFLV--AQSQCNERWPS 58
            RW+++L P  ++ G+WSL+EDKR+ V V LFGS +W+KI  S F+    Q+QC ERW +
Sbjct: 535 NRWKKSLRP--TRKGTWSLEEDKRVKVAVTLFGSQNWHKI--SQFVPGRTQTQCRERWLN 590

Query: 59  VRDPDIDLGE 68
             DP ++ G+
Sbjct: 591 CLDPKVNRGK 600



  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.315    0.132    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 1,780,645
Number of extensions: 58838
Number of successful extensions: 276
Number of sequences better than 1.0e-05: 3
Number of HSP's gapped: 343
Number of HSP's successfully gapped: 3
Length of query: 73
Length of database: 11,106,569
Length adjustment: 45
Effective length of query: 28
Effective length of database: 9,872,849
Effective search space: 276439772
Effective search space used: 276439772
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 104 (44.7 bits)