BLASTP 2.2.23 [Feb-03-2010]
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= Os06g0583500 Os06g0583500|AK103785
(174 letters)
Database: tair10
27,416 sequences; 11,106,569 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ATMG00300.1 | chrM:89617-90054 REVERSE LENGTH=146 47 5e-06
>ATMG00300.1 | chrM:89617-90054 REVERSE LENGTH=146
Length = 145
Score = 47.0 bits (110), Expect = 5e-06, Method: Compositional matrix adjust.
Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 1/69 (1%)
Query: 70 WHHRLGHLCGSRLSTLIRQGVLGHVSIDTTFDCTGCKLGKQIQLPYPISNSRTSCPFDLV 129
WH RL H+ + L+++G L + + C C GK ++ + T P D V
Sbjct: 72 WHSRLAHMSQRGMELLVKKGFLDSSKVSSLKFCEDCIYGKTHRVNFSTGQHTTKNPLDYV 131
Query: 130 HSDVWGPAP 138
HSD+WG AP
Sbjct: 132 HSDLWG-AP 139
Database: tair10
Posted date: Dec 8, 2010 11:30 AM
Number of letters in database: 11,106,569
Number of sequences in database: 27,416
Lambda K H
0.326 0.141 0.477
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 3,509,589
Number of extensions: 120261
Number of successful extensions: 253
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 253
Number of HSP's successfully gapped: 1
Length of query: 174
Length of database: 11,106,569
Length adjustment: 92
Effective length of query: 82
Effective length of database: 8,584,297
Effective search space: 703912354
Effective search space used: 703912354
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 108 (46.2 bits)