BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os06g0571300 Os06g0571300|J075123I22
         (73 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT2G45320.1  | chr2:18684182-18686107 REVERSE LENGTH=393           70   3e-13
>AT2G45320.1 | chr2:18684182-18686107 REVERSE LENGTH=393
          Length = 392

 Score = 69.7 bits (169), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 2/57 (3%)

Query: 5   FIEPLQVSMPRSNVIILTDPNSKLT--HGSAVILPIEGNYSRGNLMFQRIRSYIVSL 59
           F   +QV+MP+SNV+ILTDP S L+    + ++ P++G+YSRGNLM QRIRSYI  L
Sbjct: 141 FANFIQVTMPKSNVVILTDPASDLSIQQSNVILQPVQGDYSRGNLMLQRIRSYITFL 197
  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.327    0.143    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 1,521,800
Number of extensions: 48905
Number of successful extensions: 113
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 112
Number of HSP's successfully gapped: 1
Length of query: 73
Length of database: 11,106,569
Length adjustment: 45
Effective length of query: 28
Effective length of database: 9,872,849
Effective search space: 276439772
Effective search space used: 276439772
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 104 (44.7 bits)