BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os06g0525200 Os06g0525200|009-020-A05
         (197 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT5G41810.1  | chr5:16738302-16739474 FORWARD LENGTH=289           53   1e-07
>AT5G41810.1 | chr5:16738302-16739474 FORWARD LENGTH=289
          Length = 288

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 20/31 (64%), Positives = 25/31 (80%)

Query: 38  VWDCGSALYDSYELTSFRRQLDAAVLSCGGR 68
           VWDCGS LYDS+EL SF+RQLD+A+ +   R
Sbjct: 122 VWDCGSTLYDSFELNSFKRQLDSAISASSAR 152
  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.317    0.134    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 3,133,827
Number of extensions: 110163
Number of successful extensions: 416
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 416
Number of HSP's successfully gapped: 1
Length of query: 197
Length of database: 11,106,569
Length adjustment: 93
Effective length of query: 104
Effective length of database: 8,556,881
Effective search space: 889915624
Effective search space used: 889915624
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 109 (46.6 bits)