BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os06g0471100 Os06g0471100|Os06g0471100
         (178 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT2G26470.1  | chr2:11259316-11262362 REVERSE LENGTH=488           61   4e-10

>AT2G26470.1 | chr2:11259316-11262362 REVERSE LENGTH=488
          Length = 487

 Score = 60.8 bits (146), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 41/58 (70%), Gaps = 1/58 (1%)

Query: 22  DKVWYPVTAAIGKISFDGPECIKQVQMRPSEKP-ISTFFMKKPVKSEKKDQDHAETKA 78
           D VWYPVT+AIGK +FDGPECI+Q+ ++ S+   IS FF  K  K+++ D++   T A
Sbjct: 209 DLVWYPVTSAIGKPTFDGPECIQQIPLKTSQNSLISKFFSTKQPKTDEGDKETKSTDA 266



  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.312    0.126    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 4,071,863
Number of extensions: 168915
Number of successful extensions: 615
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 617
Number of HSP's successfully gapped: 1
Length of query: 178
Length of database: 11,106,569
Length adjustment: 92
Effective length of query: 86
Effective length of database: 8,584,297
Effective search space: 738249542
Effective search space used: 738249542
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 108 (46.2 bits)