BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os06g0292400 Os06g0292400|J065040E24
         (730 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT4G11000.1  | chr4:6731020-6732464 FORWARD LENGTH=407             60   4e-09
>AT4G11000.1 | chr4:6731020-6732464 FORWARD LENGTH=407
          Length = 406

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 44/71 (61%), Gaps = 5/71 (7%)

Query: 563 LMLLSILAASITYQAGLNPPGGFWSDDSSDPPKHKAGDPVLHNIHPHRYKAFFC-FNAFS 621
           +++++IL  + TYQAGL+PPGGFW D +     H AG   +    P  Y  FF   N F+
Sbjct: 254 ILVVAILIVTATYQAGLSPPGGFWQDTNDGRYGHMAGQMTM----PFIYAFFFIGLNGFA 309

Query: 622 FMSSIVVIMLL 632
           F+SS+ VI+++
Sbjct: 310 FVSSLYVIIII 320
  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.317    0.131    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 15,080,482
Number of extensions: 603882
Number of successful extensions: 2079
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 2082
Number of HSP's successfully gapped: 1
Length of query: 730
Length of database: 11,106,569
Length adjustment: 106
Effective length of query: 624
Effective length of database: 8,200,473
Effective search space: 5117095152
Effective search space used: 5117095152
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 115 (48.9 bits)