BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os06g0104400 Os06g0104400|AK060638
         (319 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT5G62390.1  | chr5:25052377-25054170 REVERSE LENGTH=447           70   2e-12
>AT5G62390.1 | chr5:25052377-25054170 REVERSE LENGTH=447
          Length = 446

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 48/69 (69%), Gaps = 5/69 (7%)

Query: 256 GCVAIRKAFALGNG-----KAKKKELSPQDAALLIQLNYRAHLAHRSQVLRCLRDLAVAK 310
           G + +RKAF+  NG     K K KE+ P+ AA++IQ  ++A+L  RS+ LR LRDLA+AK
Sbjct: 276 GAIVLRKAFSRRNGAVRTKKGKNKEMPPEYAAVMIQRAFKAYLIRRSKSLRALRDLAIAK 335

Query: 311 AKLKEIRCA 319
            KLKE+R +
Sbjct: 336 TKLKELRAS 344
  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.318    0.132    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 4,438,135
Number of extensions: 127024
Number of successful extensions: 200
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 199
Number of HSP's successfully gapped: 1
Length of query: 319
Length of database: 11,106,569
Length adjustment: 99
Effective length of query: 220
Effective length of database: 8,392,385
Effective search space: 1846324700
Effective search space used: 1846324700
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 112 (47.8 bits)