BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os05g0532800 Os05g0532800|AK111043
         (85 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT5G19151.1  | chr5:6428572-6429547 FORWARD LENGTH=75              50   3e-07

>AT5G19151.1 | chr5:6428572-6429547 FORWARD LENGTH=75
          Length = 74

 Score = 49.7 bits (117), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 29/33 (87%)

Query: 14 NAMRSGLVVLGAAAFGYLSFRVGFKPYLDRAQE 46
          NA+RS +VVLG+ AFGYLS  +G+KP+L++A++
Sbjct: 8  NAIRSSVVVLGSLAFGYLSLELGYKPFLEKAEQ 40



  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.317    0.131    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 1,729,318
Number of extensions: 56278
Number of successful extensions: 148
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 148
Number of HSP's successfully gapped: 1
Length of query: 85
Length of database: 11,106,569
Length adjustment: 56
Effective length of query: 29
Effective length of database: 9,571,273
Effective search space: 277566917
Effective search space used: 277566917
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 104 (44.7 bits)