BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os05g0476000 Os05g0476000|AK073548
         (215 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT2G40475.1  | chr2:16907222-16907803 REVERSE LENGTH=194           49   3e-06

>AT2G40475.1 | chr2:16907222-16907803 REVERSE LENGTH=194
          Length = 193

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%)

Query: 14 DGEFYARLLTKESSQGNPSFRYYGAGTGAVPFVWESHPGTPK 55
          +G   ++++ KESSQ N S R Y  G  +VPF+WE+ PGTPK
Sbjct: 10 NGVISSKIIVKESSQVNSSSRIYYYGGASVPFLWETRPGTPK 51



  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.318    0.133    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 4,798,226
Number of extensions: 189805
Number of successful extensions: 547
Number of sequences better than 1.0e-05: 2
Number of HSP's gapped: 545
Number of HSP's successfully gapped: 2
Length of query: 215
Length of database: 11,106,569
Length adjustment: 94
Effective length of query: 121
Effective length of database: 8,529,465
Effective search space: 1032065265
Effective search space used: 1032065265
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 109 (46.6 bits)