BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os05g0466800 Os05g0466800|016-051-C02
         (44 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT3G55960.1  | chr3:20760797-20762892 REVERSE LENGTH=306           59   4e-10

>AT3G55960.1 | chr3:20760797-20762892 REVERSE LENGTH=306
          Length = 305

 Score = 59.3 bits (142), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (78%)

Query: 1   LMGVIFPLLKHLSLQNDVRPALYETFHMPEWFQRHGIP 38
           L+ VI PLLK LS ++DVRP LY+ F MPEWF++ GIP
Sbjct: 262 LLDVILPLLKQLSEEDDVRPTLYDRFRMPEWFEKQGIP 299



  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.328    0.143    0.465 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 958,977
Number of extensions: 22643
Number of successful extensions: 74
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 74
Number of HSP's successfully gapped: 1
Length of query: 44
Length of database: 11,106,569
Length adjustment: 18
Effective length of query: 26
Effective length of database: 10,613,081
Effective search space: 275940106
Effective search space used: 275940106
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 104 (44.7 bits)