BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os05g0390600 Os05g0390600|Os05g0390600
         (385 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT5G26230.1  | chr5:9173517-9174542 REVERSE LENGTH=342             67   1e-11
>AT5G26230.1 | chr5:9173517-9174542 REVERSE LENGTH=342
          Length = 341

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 29/44 (65%), Positives = 39/44 (88%), Gaps = 3/44 (6%)

Query: 30 FTVTLSPASKQRSAAQLCPADELFYKGQLLPLQLSPRISMVRTL 73
          F +++SP   +++++ LCPADELFYKGQLLPLQLSPR+S+VRTL
Sbjct: 28 FNISISP---RKASSSLCPADELFYKGQLLPLQLSPRLSLVRTL 68
  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.319    0.130    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 3,444,337
Number of extensions: 72176
Number of successful extensions: 165
Number of sequences better than 1.0e-05: 2
Number of HSP's gapped: 165
Number of HSP's successfully gapped: 2
Length of query: 385
Length of database: 11,106,569
Length adjustment: 100
Effective length of query: 285
Effective length of database: 8,364,969
Effective search space: 2384016165
Effective search space used: 2384016165
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 113 (48.1 bits)