BLASTP 2.2.23 [Feb-03-2010]
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= Os05g0380700 Os05g0380700|AK106900
(136 letters)
Database: tair10
27,416 sequences; 11,106,569 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ATMG00710.1 | chrM:207553-207915 REVERSE LENGTH=121 47 4e-06
>ATMG00710.1 | chrM:207553-207915 REVERSE LENGTH=121
Length = 120
Score = 46.6 bits (109), Expect = 4e-06, Method: Compositional matrix adjust.
Identities = 21/67 (31%), Positives = 40/67 (59%), Gaps = 3/67 (4%)
Query: 1 MPPSYWAEGLATATYLLNRRPSSSVNNSIPFQLLHRKIPDYSMLHVFGCLCYPNLSATAA 60
+P ++ A+ TA +++N+ PS+++N +P ++ + +P YS L FGC+ Y +
Sbjct: 18 LPKTFRADAANTAVHIINKYPSTAINFHVPDEVWFQSVPTYSYLRRFGCVAYIHCDEG-- 75
Query: 61 HKLAPRS 67
KL PR+
Sbjct: 76 -KLKPRA 81
Database: tair10
Posted date: Dec 8, 2010 11:30 AM
Number of letters in database: 11,106,569
Number of sequences in database: 27,416
Lambda K H
0.329 0.140 0.477
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 3,109,761
Number of extensions: 114317
Number of successful extensions: 262
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 262
Number of HSP's successfully gapped: 1
Length of query: 136
Length of database: 11,106,569
Length adjustment: 88
Effective length of query: 48
Effective length of database: 8,693,961
Effective search space: 417310128
Effective search space used: 417310128
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 106 (45.4 bits)