BLASTP 2.2.23 [Feb-03-2010]
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= Os05g0307000 Os05g0307000|J080310A01
(64 letters)
Database: tair10
27,416 sequences; 11,106,569 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AT5G42210.1 | chr5:16867865-16870568 FORWARD LENGTH=283 51 1e-07
>AT5G42210.1 | chr5:16867865-16870568 FORWARD LENGTH=283
Length = 282
Score = 51.2 bits (121), Expect = 1e-07, Method: Compositional matrix adjust.
Identities = 22/51 (43%), Positives = 31/51 (60%)
Query: 2 PKLGEQKLLIIALLGGCVHAFIYSIAWTPWVPYLGASFVIVSILVNPSVSS 52
P L E++LL I L GC H F+ +AW+ WVPY+ A F + SI + + S
Sbjct: 149 PALKEERLLSIGLFFGCAHMFLLCVAWSSWVPYMAAIFALFSIFPSSCMRS 199
Database: tair10
Posted date: Dec 8, 2010 11:30 AM
Number of letters in database: 11,106,569
Number of sequences in database: 27,416
Lambda K H
0.328 0.144 0.467
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 1,357,817
Number of extensions: 39347
Number of successful extensions: 114
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 114
Number of HSP's successfully gapped: 1
Length of query: 64
Length of database: 11,106,569
Length adjustment: 37
Effective length of query: 27
Effective length of database: 10,092,177
Effective search space: 272488779
Effective search space used: 272488779
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 104 (44.7 bits)