BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os04g0645900 Os04g0645900|Os04g0645900
         (347 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT3G52240.1  | chr3:19372902-19375799 REVERSE LENGTH=681           52   6e-07
>AT3G52240.1 | chr3:19372902-19375799 REVERSE LENGTH=681
          Length = 680

 Score = 51.6 bits (122), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%)

Query: 17  DGEMERVLERQAELIGQYEAEEEAQRQWEKQFNENRSSA 55
           D  +ER LE +A++IG +E  EE QR+WEK F EN+SSA
Sbjct: 229 DINLERALENRAQVIGSFEEMEETQREWEKNFRENKSSA 267
  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.305    0.123    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 8,149,179
Number of extensions: 364951
Number of successful extensions: 1026
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 1026
Number of HSP's successfully gapped: 1
Length of query: 347
Length of database: 11,106,569
Length adjustment: 99
Effective length of query: 248
Effective length of database: 8,392,385
Effective search space: 2081311480
Effective search space used: 2081311480
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 112 (47.8 bits)