BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os04g0644300 Os04g0644300|AK062549
         (175 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT2G12550.1  | chr2:5114881-5118486 FORWARD LENGTH=563             47   6e-06
>AT2G12550.1 | chr2:5114881-5118486 FORWARD LENGTH=563
          Length = 562

 Score = 46.6 bits (109), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 31/41 (75%)

Query: 1   KKLAAEALRINENDADKALDLLTDPEQNCILQHKIMSKAKR 41
           ++LAAE+LR NEND  KALD+LTDP+ N  +Q  I S+ ++
Sbjct: 371 RELAAESLRRNENDIQKALDILTDPKVNSTIQAYIESRKRK 411
  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.309    0.126    0.343 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 2,576,647
Number of extensions: 58585
Number of successful extensions: 115
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 115
Number of HSP's successfully gapped: 1
Length of query: 175
Length of database: 11,106,569
Length adjustment: 92
Effective length of query: 83
Effective length of database: 8,584,297
Effective search space: 712496651
Effective search space used: 712496651
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 108 (46.2 bits)