BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os04g0626500 Os04g0626500|AK069923
         (258 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT3G14460.1  | chr3:4851990-4856264 REVERSE LENGTH=1425            50   2e-06
>AT3G14460.1 | chr3:4851990-4856264 REVERSE LENGTH=1425
          Length = 1424

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 31/50 (62%)

Query: 188  RCSKLQCLPAGLHRLTSLKRLKIIGCPSIRSLPKGGLPSSLQELDVGYCN 237
             C KLQ LP  L  LTSL  L II CP I ++P GG PS+L+ L +  C+
Sbjct: 1248 NCKKLQALPEKLFGLTSLLSLFIIKCPEIETIPGGGFPSNLRTLCISLCD 1297
  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.323    0.141    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 5,035,977
Number of extensions: 194663
Number of successful extensions: 957
Number of sequences better than 1.0e-05: 2
Number of HSP's gapped: 965
Number of HSP's successfully gapped: 2
Length of query: 258
Length of database: 11,106,569
Length adjustment: 96
Effective length of query: 162
Effective length of database: 8,474,633
Effective search space: 1372890546
Effective search space used: 1372890546
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 110 (47.0 bits)