BLASTP 2.2.23 [Feb-03-2010]
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= Os04g0603400 Os04g0603400|AK107076
(92 letters)
Database: tair10
27,416 sequences; 11,106,569 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AT5G43150.1 | chr5:17325076-17325689 FORWARD LENGTH=92 49 4e-07
>AT5G43150.1 | chr5:17325076-17325689 FORWARD LENGTH=92
Length = 91
Score = 49.3 bits (116), Expect = 4e-07, Method: Compositional matrix adjust.
Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 4/63 (6%)
Query: 4 WRKKVVFPARRAWAAVSTRVRARKPGSGGSILKLHEDVQTCGYKDVQVMFEILKSELEES 63
W + FP RR W + RV R G +L+L DV +C Y+D+ +M+ +L + +
Sbjct: 9 WWNTMAFPTRRIWNRFTVRVGFRHSG----LLRLEHDVSSCEYEDIHIMWNLLHKNEDLT 64
Query: 64 RAP 66
R P
Sbjct: 65 RVP 67
Database: tair10
Posted date: Dec 8, 2010 11:30 AM
Number of letters in database: 11,106,569
Number of sequences in database: 27,416
Lambda K H
0.319 0.130 0.400
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 1,567,627
Number of extensions: 47055
Number of successful extensions: 122
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 122
Number of HSP's successfully gapped: 1
Length of query: 92
Length of database: 11,106,569
Length adjustment: 63
Effective length of query: 29
Effective length of database: 9,379,361
Effective search space: 272001469
Effective search space used: 272001469
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 104 (44.7 bits)