BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os04g0564500 Os04g0564500|J065115E08
         (99 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT4G38260.1  | chr4:17937077-17938210 REVERSE LENGTH=276           86   4e-18
>AT4G38260.1 | chr4:17937077-17938210 REVERSE LENGTH=276
          Length = 275

 Score = 85.9 bits (211), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 41/71 (57%), Positives = 50/71 (70%), Gaps = 1/71 (1%)

Query: 2   IQGNQCPLEYAEEIAKEADQYNGFNLVLADVQSGNMAYISNR-PEGDPVVQKVLPGFHVL 60
           +Q  + P E+AEEI  E   YNGFNLV+A V S +M YI+NR P GD +V +V PG HVL
Sbjct: 88  LQSEKSPAEFAEEIQDEISLYNGFNLVVAHVLSKSMIYITNRPPHGDKLVTQVSPGIHVL 147

Query: 61  SNAAIDCPWPK 71
           SNA +D PWPK
Sbjct: 148 SNANLDSPWPK 158
  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.318    0.135    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 2,132,052
Number of extensions: 76481
Number of successful extensions: 189
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 190
Number of HSP's successfully gapped: 1
Length of query: 99
Length of database: 11,106,569
Length adjustment: 69
Effective length of query: 30
Effective length of database: 9,214,865
Effective search space: 276445950
Effective search space used: 276445950
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 104 (44.7 bits)