BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os04g0429200 Os04g0429200|AK070730
         (145 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT4G39370.3  | chr4:18306392-18308625 FORWARD LENGTH=506           65   1e-11
>AT4G39370.3 | chr4:18306392-18308625 FORWARD LENGTH=506
          Length = 505

 Score = 65.1 bits (157), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/65 (53%), Positives = 45/65 (69%), Gaps = 1/65 (1%)

Query: 58  DRLYYTGGLKNLGNNCFLNVILQALASCDGFVSSLDNLL-GSEDVLPEEKSEKMPLIFAL 116
           D  +   GL+NLGNNCFLNVILQALASC  F S L  +L  +   L  E+ E++PL FAL
Sbjct: 68  DDSFLVPGLQNLGNNCFLNVILQALASCKDFRSFLQWVLEDARGSLAGEQEEQLPLTFAL 127

Query: 117 SSLIK 121
           S+L++
Sbjct: 128 SALLQ 132
  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.316    0.135    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 2,906,250
Number of extensions: 104246
Number of successful extensions: 245
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 244
Number of HSP's successfully gapped: 1
Length of query: 145
Length of database: 11,106,569
Length adjustment: 89
Effective length of query: 56
Effective length of database: 8,666,545
Effective search space: 485326520
Effective search space used: 485326520
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 107 (45.8 bits)