BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os04g0266400 Os04g0266400|AK068202
         (313 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT5G52230.1  | chr5:21208097-21211634 REVERSE LENGTH=747           53   2e-07
>AT5G52230.1 | chr5:21208097-21211634 REVERSE LENGTH=747
          Length = 746

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 35/54 (64%), Gaps = 1/54 (1%)

Query: 242 GLPEGWVKEI-IFRKCNDGIRKDPYYTDPVSRHVFRTLKSVINYLETGQITKHA 294
           GLPEGW+K++ I  +     R+DP++ DP S ++F++ K    Y+ETG I  +A
Sbjct: 38  GLPEGWIKKLEITNRSGRKTRRDPFFIDPKSEYIFQSFKDASRYVETGNIGHYA 91
  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.318    0.136    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 6,327,100
Number of extensions: 250708
Number of successful extensions: 597
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 598
Number of HSP's successfully gapped: 1
Length of query: 313
Length of database: 11,106,569
Length adjustment: 98
Effective length of query: 215
Effective length of database: 8,419,801
Effective search space: 1810257215
Effective search space used: 1810257215
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 111 (47.4 bits)