BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os04g0165500 Os04g0165500|AK105123
         (70 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT5G22875.1  | chr5:7651307-7651603 FORWARD LENGTH=70              74   1e-14

>AT5G22875.1 | chr5:7651307-7651603 FORWARD LENGTH=70
          Length = 69

 Score = 74.3 bits (181), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 46/70 (65%), Gaps = 1/70 (1%)

Query: 1  MSKARNVLVXXXXXXXXXXXXXXXXYFVKSKNKPIIDSSKPLPPQATFRGPYVNTGSRDI 60
          M+ +RN++V                Y   SK +P+ID +KPLPPQATFRGPY+NTGSRD+
Sbjct: 1  MAPSRNIVVATGLVLFASAGLAFPFYMASSK-QPVIDPTKPLPPQATFRGPYINTGSRDV 59

Query: 61 GPDYTDYPKK 70
          GPD+  YPKK
Sbjct: 60 GPDHRTYPKK 69



  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.314    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 1,279,601
Number of extensions: 37840
Number of successful extensions: 61
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 61
Number of HSP's successfully gapped: 1
Length of query: 70
Length of database: 11,106,569
Length adjustment: 42
Effective length of query: 28
Effective length of database: 9,955,097
Effective search space: 278742716
Effective search space used: 278742716
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 104 (44.7 bits)