BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os04g0117100 Os04g0117100|AK121763
         (52 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT5G15320.1  | chr5:4977647-4978658 FORWARD LENGTH=54              58   1e-09

>AT5G15320.1 | chr5:4977647-4978658 FORWARD LENGTH=54
          Length = 53

 Score = 57.8 bits (138), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 37/53 (69%), Gaps = 1/53 (1%)

Query: 1  MPFTPGPYSGVSTLALVARASALGVGVVYGAVKLSILK-ATKPNKKEAANAHH 52
          M   PG YSG S+LALVARASA G+G+VYG +KL +LK  +   KK  A AHH
Sbjct: 1  MTLPPGLYSGTSSLALVARASAFGLGLVYGNMKLKVLKIKSMSQKKVEATAHH 53



  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.314    0.129    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 955,939
Number of extensions: 20728
Number of successful extensions: 35
Number of sequences better than 1.0e-05: 2
Number of HSP's gapped: 35
Number of HSP's successfully gapped: 2
Length of query: 52
Length of database: 11,106,569
Length adjustment: 25
Effective length of query: 27
Effective length of database: 10,421,169
Effective search space: 281371563
Effective search space used: 281371563
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 105 (45.1 bits)