BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os03g0581800 Os03g0581800|AK121839
         (91 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT2G20820.2  | chr2:8964450-8965237 FORWARD LENGTH=103             53   3e-08

>AT2G20820.2 | chr2:8964450-8965237 FORWARD LENGTH=103
          Length = 102

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 21/33 (63%), Positives = 26/33 (78%)

Query: 27 LAGAADHHGPPKVNIWQEPMNPANWKEEQFVLA 59
          LAGAADHHG  KV+ W++P NP NWKEE ++ A
Sbjct: 32 LAGAADHHGSTKVDFWKQPTNPGNWKEEHWIQA 64



  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.315    0.132    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 1,677,511
Number of extensions: 53989
Number of successful extensions: 133
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 133
Number of HSP's successfully gapped: 1
Length of query: 91
Length of database: 11,106,569
Length adjustment: 62
Effective length of query: 29
Effective length of database: 9,406,777
Effective search space: 272796533
Effective search space used: 272796533
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 104 (44.7 bits)