BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os03g0420000 Os03g0420000|Os03g0420000
         (124 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT2G42710.1  | chr2:17782352-17784830 FORWARD LENGTH=416           65   1e-11

>AT2G42710.1 | chr2:17782352-17784830 FORWARD LENGTH=416
          Length = 415

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/70 (55%), Positives = 47/70 (67%), Gaps = 10/70 (14%)

Query: 18  PQRQQWTREEMRFVKDAGPSITPVSYPARVAPLPDDRPA--NEGLRG------EGERIEM 69
           P+   WTREE+R+VKD+ PSI PVSY  RVAPLP+DR A  NEG R       E +RIE+
Sbjct: 91  PESANWTREEIRYVKDS-PSINPVSYAQRVAPLPEDRVAGENEGDRTPEEMERERKRIEL 149

Query: 70  DATRARRSFF 79
           +  RARR F 
Sbjct: 150 E-NRARRRFL 158



  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.316    0.134    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 2,430,672
Number of extensions: 97094
Number of successful extensions: 214
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 213
Number of HSP's successfully gapped: 1
Length of query: 124
Length of database: 11,106,569
Length adjustment: 86
Effective length of query: 38
Effective length of database: 8,748,793
Effective search space: 332454134
Effective search space used: 332454134
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 105 (45.1 bits)