BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os03g0399900 Os03g0399900|AK099576
         (127 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT1G19715.3  | chr1:6816934-6819432 REVERSE LENGTH=602             45   7e-06

>AT1G19715.3 | chr1:6816934-6819432 REVERSE LENGTH=602
          Length = 601

 Score = 45.4 bits (106), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 1/57 (1%)

Query: 70  THVVTSLKLVTSQRTIGPFGNGAGTPFAVPVLNNGSVVGFFARAGPYLESIGIYVHP 126
           T  V SL   +++R  GPFG  +GT FA+P  +   ++GF  +AG YL++IG++  P
Sbjct: 100 TICVRSLTFESNRRKYGPFGVDSGTFFALPK-SGSKIIGFHGKAGWYLDAIGVHTQP 155



  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.322    0.145    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 2,007,418
Number of extensions: 72062
Number of successful extensions: 232
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 257
Number of HSP's successfully gapped: 1
Length of query: 127
Length of database: 11,106,569
Length adjustment: 87
Effective length of query: 40
Effective length of database: 8,721,377
Effective search space: 348855080
Effective search space used: 348855080
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 105 (45.1 bits)