BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os03g0357500 Os03g0357500|AK107779
         (264 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT3G63095.1  | chr3:23315506-23316258 FORWARD LENGTH=251           69   3e-12
>AT3G63095.1 | chr3:23315506-23316258 FORWARD LENGTH=251
          Length = 250

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 37/51 (72%)

Query: 213 AYRDCCRWLQEVSKDCVCDALMRLPPFLVKPQHTYVVRVGRTCKITYRCGG 263
           A ++CC+WL+++  +CVCD L+RLPP L KP H Y V V  +C +T+ CGG
Sbjct: 196 AQQECCKWLKQMDNECVCDLLVRLPPLLAKPIHNYTVFVDESCIVTFVCGG 246
  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.324    0.136    0.442 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 2,622,618
Number of extensions: 56824
Number of successful extensions: 239
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 239
Number of HSP's successfully gapped: 1
Length of query: 264
Length of database: 11,106,569
Length adjustment: 97
Effective length of query: 167
Effective length of database: 8,447,217
Effective search space: 1410685239
Effective search space used: 1410685239
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 111 (47.4 bits)