BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os03g0243800 Os03g0243800|J075143A17
         (122 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT4G35987.1  | chr4:17035121-17036823 FORWARD LENGTH=305           47   2e-06
>AT4G35987.1 | chr4:17035121-17036823 FORWARD LENGTH=305
          Length = 304

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 39/70 (55%), Gaps = 14/70 (20%)

Query: 52  NDQQDKNDTNKISRKTSRGFDLIECHMLPISQSTKSHGDSSSRNENIVECHNDVRVCYKL 111
           +D Q + +T +ISRK ++GF+LI C ++          DSS +++       +  VCY L
Sbjct: 24  SDSQSQTETKRISRKATQGFNLIPCQVV----------DSSPQSDK----SREASVCYTL 69

Query: 112 PCEGSPKLNL 121
           P  GSPKL L
Sbjct: 70  PITGSPKLYL 79
  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.311    0.128    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 1,792,383
Number of extensions: 62522
Number of successful extensions: 141
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 140
Number of HSP's successfully gapped: 1
Length of query: 122
Length of database: 11,106,569
Length adjustment: 86
Effective length of query: 36
Effective length of database: 8,748,793
Effective search space: 314956548
Effective search space used: 314956548
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 105 (45.1 bits)