BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os02g0791300 Os02g0791300|J100039D05
         (203 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT5G57780.1  | chr5:23405505-23406008 REVERSE LENGTH=168           53   1e-07

>AT5G57780.1 | chr5:23405505-23406008 REVERSE LENGTH=168
          Length = 167

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 38/64 (59%), Gaps = 7/64 (10%)

Query: 141 VARAMVRKRASVLKEIVPGGKAL-DMCALLGETLDYAVSLKAQVDVMQ------LLVRTL 193
            A+  VRKR  +LK +VPGG+ + D   L+ ETLDY V L+AQVDVM+      L  R L
Sbjct: 101 TAKTWVRKRTDLLKSLVPGGELIDDKDYLIRETLDYIVYLRAQVDVMRTVAAVDLFTRNL 160

Query: 194 QEQK 197
              +
Sbjct: 161 TNDR 164



  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.322    0.133    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 2,052,542
Number of extensions: 45336
Number of successful extensions: 161
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 162
Number of HSP's successfully gapped: 1
Length of query: 203
Length of database: 11,106,569
Length adjustment: 94
Effective length of query: 109
Effective length of database: 8,529,465
Effective search space: 929711685
Effective search space used: 929711685
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 109 (46.6 bits)