BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os02g0593400 Os02g0593400|AK072362
         (96 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT5G63135.1  | chr5:25325253-25326440 REVERSE LENGTH=100           61   1e-10

>AT5G63135.1 | chr5:25325253-25326440 REVERSE LENGTH=100
          Length = 99

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 2/65 (3%)

Query: 1  MLQFPALMRQWPSP-PLIPASTLLPVP-ATTQEDELLLAMAESDLEDKLNEIRKTNSNLV 58
          MLQFP LM Q+PS    IPAS LLP+     Q +E+LLAM E++ E+K NEIRK +  L 
Sbjct: 1  MLQFPTLMTQFPSSTKTIPASYLLPLQWPQPQNEEILLAMEEAEFEEKCNEIRKMSPALP 60

Query: 59 IIGKP 63
          +IGKP
Sbjct: 61 VIGKP 65



  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.313    0.133    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 1,599,424
Number of extensions: 53014
Number of successful extensions: 167
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 166
Number of HSP's successfully gapped: 1
Length of query: 96
Length of database: 11,106,569
Length adjustment: 66
Effective length of query: 30
Effective length of database: 9,297,113
Effective search space: 278913390
Effective search space used: 278913390
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 104 (44.7 bits)