BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os02g0558300 Os02g0558300|Os02g0558300
         (109 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT4G10100.1  | chr4:6309091-6309381 FORWARD LENGTH=97              82   8e-17
>AT4G10100.1 | chr4:6309091-6309381 FORWARD LENGTH=97
          Length = 96

 Score = 81.6 bits (200), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 39/70 (55%), Positives = 50/70 (71%)

Query: 40  RDLTGVTEAPVEVPAGSTAGDCLARVLAAFPRLEEIRRSMVLALNEEYAPEDAAVGDGDE 99
           R+LTGV +  +++P+GST   CL  ++  FP LEE+R  +VLALNEEY  + A V   DE
Sbjct: 27  RELTGVPDLTLKMPSGSTTQKCLDELVLKFPSLEEVRSCVVLALNEEYTTDSAIVQHRDE 86

Query: 100 LAIIPPISGG 109
           LAIIPPISGG
Sbjct: 87  LAIIPPISGG 96
  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.315    0.136    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 1,499,245
Number of extensions: 46245
Number of successful extensions: 57
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 57
Number of HSP's successfully gapped: 1
Length of query: 109
Length of database: 11,106,569
Length adjustment: 78
Effective length of query: 31
Effective length of database: 8,968,121
Effective search space: 278011751
Effective search space used: 278011751
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 104 (44.7 bits)